PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00002.310
Common NameAMTR_s00002p00241970, LOC18429316
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 247aa    MW: 26395.7 Da    PI: 6.8407
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.310genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.96.2e-3711106196
                                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 
                                               aCa+Ck++rrkC++dC+lapyfp +q k+f+n+h+lFG++++lk+l++l++ ++++am+s++yeA+ar 
  evm_27.model.AmTr_v1.0_scaffold00002.310  11 ACASCKYQRRKCSADCPLAPYFPPDQLKQFQNAHRLFGVRKILKILEQLNPAQKSEAMKSIMYEANARE 79 
                                               7******************************************************************** PP

                                    DUF260  70 rdPvyGavgvilklqqqleqlkaelal 96 
                                               r P +G++g+i++l++q+e + +e ++
  evm_27.model.AmTr_v1.0_scaffold00002.310  80 RYPAHGCMGIIHALHKQIEMAMQERDE 106
                                               *******************99998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.83910111IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-3711105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MAGKASGTGQ ACASCKYQRR KCSADCPLAP YFPPDQLKQF QNAHRLFGVR KILKILEQLN  60
PAQKSEAMKS IMYEANARER YPAHGCMGII HALHKQIEMA MQERDELVRC LALCQQQQQQ  120
EHHGSMVVGQ GSSLQMVQPM GGMSVHHGGG GMGYNPSWVV HGGSGGVVNG GGMVYGGGGG  180
GLNEVGQGGG GVEYDVISPF FEGVDDRQSY VDSKGGGHES SSESSLKETQ SMEKVSDNEL  240
KLFDIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838665.10.0PREDICTED: LOB domain-containing protein 27
TrEMBLW1P0T50.0W1P0T5_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.18e-39LOB domain-containing protein 27
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]